PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Kalax.0351s0029.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Saxifragales; Crassulaceae; Kalanchoe
Family G2-like
Protein Properties Length: 316aa    MW: 34228.3 Da    PI: 8.2286
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Kalax.0351s0029.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.43.4e-3349103155
              G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                          kprlrWt +LHerFv+av+qLGG++kAtPk+i+++m+vkgLtl h+kSHLQkYRl
  Kalax.0351s0029.1.p  49 KPRLRWTADLHERFVDAVTQLGGPNKATPKAIMRTMGVKGLTLFHLKSHLQKYRL 103
                          79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129411.20346106IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.6E-3146104IPR009057Homeodomain-like
SuperFamilySSF466891.68E-1649105IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-2449104IPR006447Myb domain, plants
PfamPF002498.1E-851102IPR001005SANT/Myb domain
PfamPF143791.0E-15147192IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 316 aa     Download sequence    Send to blast
MQSGSCGILE KMFPLLMQPR DGGLVTLGHG RDDIHGVGDP CLVLTSDPKP RLRWTADLHE  60
RFVDAVTQLG GPNKATPKAI MRTMGVKGLT LFHLKSHLQK YRLGKQSGKD MRDIVKDGLP  120
GSYLIEDPEI NNCAPKLPTP DTNEGFEVKE ALRAQMEVQS KLHLQVEAEK HLQIRQDAER  180
RYMAMLDSAC KMLAGHHLGD AVKDKSRCMG ANKPPPTTFT PNAVPPYTLQ PSTVPGLHGL  240
EELVPGLHTQ RADCSTESCL TSHGSPAGYT LQVPPSGSKK RVLNADSVAQ CLSWGDANMR  300
LPNVGVSQGI VGYST*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008351120.11e-128PREDICTED: myb family transcription factor APL-like isoform X1
SwissprotQ9SAK54e-48APL_ARATH; Myb family transcription factor APL
TrEMBLM5WGF61e-126M5WGF6_PRUPE; Myb family transcription factor APL
STRINGGLYMA09G02030.11e-117(Glycine max)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.15e-63G2-like family protein